PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009582m
Common NameCARUB_v10009313mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Trihelix
Protein Properties Length: 354aa    MW: 40300.1 Da    PI: 8.3006
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009582mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix859e-2789170286
         trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      W ++e++ Li +rr m+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k +++++    s +++y++++e
  Carubv10009582m  89 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKYHDRGN---GSAKMSYYKEIE 170
                      ********************************************************************84...566899***998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-479150IPR009057Homeodomain-like
PROSITE profilePS500907.97981145IPR017877Myb-like domain
SMARTSM007170.009685147IPR001005SANT/Myb domain
CDDcd122031.97E-2987152No hitNo description
PfamPF138373.3E-2088171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MFISDKSRPT DFYKDDNPNS STAATRDMMI DVTTPNEAVV DLQPHHHHHH HHHNHNHHLN  60
QSQPQQILLG DSSSEDHEVK APKKRAETWV QDETRSLIMF RRGMDGLFNT SKSNKHLWEQ  120
ISAKMREKGF DRSPTMCTDK WRNLLKEFKK AKYHDRGNGS AKMSYYKEIE DILRERSKKV  180
TTTQYNKSPS TPPPTTAKVD SFMQFSDKGF DDTSISFGSV EANGRPALNL ERRLDHDGHP  240
LAITTVDAVA ANGVTPWNWR ETPGNGGDGH GQPFGGRVIT VKFGDYTRRI GIDGSCEAIK  300
EAIRSAFGLR TRRAFWLEDE DQIVRSLDRE MPLGNYLLHL DDGKIKLNIV WIV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A7e-5683168186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2283050.0AK228305.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-74-C23.
GenBankATHGT0.0L36806.1 Arabidopsis thaliana (clone pDGT1) GT-1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307688.10.0hypothetical protein CARUB_v10009313mg
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLR0GXP30.0R0GXP3_9BRAS; Uncharacterized protein
STRINGscaffold_101505.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein